PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000723614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 368aa    MW: 39663.1 Da    PI: 10.1286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000723614genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14e-185097148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell++++k+ G g+W+t +++ g+ R++k+c++rw +yl
    MDP0000723614 50 RGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 97
                     89******************************99************97 PP

2Myb_DNA-binding46.77.3e-15108148648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000723614 108 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 148
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-224199IPR009057Homeodomain-like
PROSITE profilePS5129416.8184597IPR017930Myb domain
SuperFamilySSF466894.77E-2947144IPR009057Homeodomain-like
SMARTSM007177.9E-144999IPR001005SANT/Myb domain
PfamPF002494.3E-165097IPR001005SANT/Myb domain
CDDcd001671.03E-115297No hitNo description
PROSITE profilePS5129424.39798152IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-24100153IPR009057Homeodomain-like
SMARTSM007172.7E-13102150IPR001005SANT/Myb domain
PfamPF002491.2E-13108148IPR001005SANT/Myb domain
CDDcd001671.48E-11108148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MRNPSSSSKA AAAASAKMQT TITASSSSSK AAGVAGGTKT PCCAKVGLKR GPWTPEEDEL  60
LANYIKKEGE GRWRTLPKRA GLLRCGKSCR LRWMNYLRPS VKRGQIAPDE EDLILRLHRL  120
LGNRWSLIAG RIPGRTDNEI KNYWNTHLSK KLISQGIDPR THKPLNXDHH SAADDXDVDN  180
TNKSTAVASS SKANDRFSNP NPSPPSDRLV HKEGDPNNSR NDGNIAIADH DLGTIVXGFA  240
NMITSINNPD ASSSAAATGT LSLRSNNSHG GVLLXGGGNE EDDVFSSFLN SLINEDPFPG  300
QHQLQQVLQN GNVSAHAAAA RSENLPLIXM TSVLRRHQHL AGSLLCSCLL LSSKMITRXL  360
MIKRSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26481525108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.169090.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201120.0KJ020112.1 Malus hybrid cultivar MYB12a protein (MYB12a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008349410.10.0PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB5-like
SwissprotQ388505e-84MYB5_ARATH; Transcription repressor MYB5
TrEMBLX2EXK40.0X2EXK4_9R
STRINGVIT_06s0004g00570.t014e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.16e-83myb domain protein 5